DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and FLN1

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_190977.1 Gene:FLN1 / 824576 AraportID:AT3G54090 Length:471 Species:Arabidopsis thaliana


Alignment Length:403 Identity:78/403 - (19%)
Similarity:135/403 - (33%) Gaps:115/403 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PTDDTQGAFHTPRKVICFGNVLLD--RLVQLED----PQLLERFGLELGSKGELDMEKLNQLAAE 75
            |.||       |..|.|||.|..:  .:|::.|    |.:..::               ..|..:
plant    97 PYDD-------PPLVCCFGAVQKEFVPVVRVHDNPMHPDMYSQW---------------KMLQWD 139

  Fly    76 ASESSRCLTNPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHT 140
            ..|..|.   |||...|.|....:||..|.|.|.||.|...:||..::....::.|....::...
plant   140 PPEFGRA---PGGPPSNVAISHVRLGGRAAFMGKVGEDDFGDELVLMMNQERVQTRAVKFDENSK 201

  Fly   141 GQC--VCLMYQDNPTLYANIGA-------SAQFEVQTLSHA-VSHEGQSFLRPVERKQILYVEGF 195
            ..|  |.:.::|...:...:..       :::..:..|..| :.|.....|.....:..|:.   
plant   202 TACTRVKIKFKDGKMMAETVKEPPEDSLFASELNLAVLKEARIFHFNSEVLTSPTMQSTLFT--- 263

  Fly   196 FVPQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAF----FLFGNRQEFEALA 256
                       .:|...:....:..:|:.|..:.::.....||.:.|:    .:..::||.|.|.
plant   264 -----------AIQWSKKFGGLIFFDLNLPLPLWRSRNETRKLIKKAWNEANIIEVSQQELEFLL 317

  Fly   257 EA--------------AGGFRNVDELADHL---------LQSGGTKVIFVTNGSAGVQVITNYVE 298
            :.              |..|.......|:.         |.....|::.||:|:..:...|...:
plant   318 DEDYYERRRNYTPQYFAEDFDQTKNRRDYYHYTPEEIKSLWHDKLKLLVVTDGTLRLHYYTPTFD 382

  Fly   299 ELAPPGPVSFEDFRAQRVEQLV-----DATGAGDAFVAGFLHAWLEKRSLGECIRMAS------- 351
            .:.    :..||.       |:     |.||:|||.|||.:      |.|..|..|..       
plant   383 GVV----IGTEDV-------LITPFTCDRTGSGDAVVAGIM------RKLTTCPEMFEDQDVMER 430

  Fly   352 ----SVAAKVVTQ 360
                :|||.::.|
plant   431 QLRFAVAAGIIAQ 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 75/392 (19%)
PTZ00247 28..366 CDD:240328 75/392 (19%)
FLN1NP_190977.1 PLN02543 1..471 CDD:215299 78/403 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.