DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and zgc:136858

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001035392.1 Gene:zgc:136858 / 678543 ZFINID:ZDB-GENE-060421-6632 Length:700 Species:Danio rerio


Alignment Length:393 Identity:83/393 - (21%)
Similarity:135/393 - (34%) Gaps:114/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GNPPTDDTQGAFHTPRKVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASE 78
            ||..|..|... ....|.|..|.:.:|.:.:....:||  ||                       
Zfish   336 GNIKTQKTMDQ-KMDSKTIVIGGINVDFIAKGTTKKLL--FG----------------------- 374

  Fly    79 SSRCLTNP-------GGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIR--DRGIEARLQT 134
                .|||       ||...|.|..|.:||...||..|:|.|.|::.:....:  |....|||| 
Zfish   375 ----QTNPGSVCQSFGGVGRNIADCLSRLGHKPLFISAIGKDSHSDAVLNYCKHMDTSAVARLQ- 434

  Fly   135 VEDAHTGQCVCLMYQDNPTLYANIG---ASAQFEVQTLSHAVSH---------EGQ------SFL 181
              |..|. ..|.:..::..|...:|   ...|.:.|.:|..|..         :|.      :::
Zfish   435 --DQRTA-TYCAVITESGELSLGLGDMDIHQQIQEQYVSQFVDQLSSASLIVLDGNIPVSTINYV 496

  Fly   182 RPVERKQILYVEGFFVPQRSD-VCDYIVQHLVRERRRLALNLSAPYIVR---KNHQAMM----KL 238
            ..:.:|..:.|  :|.|..:| .|...:....:     ||..::|.:..   .||...:    :|
Zfish   497 CRIAKKHAVPV--WFEPTDADKACKPFLSESWK-----ALAFTSPNLTELCTMNHTLGLPTPAEL 554

  Fly   239 ARAAFFLFGNRQEFEALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPP 303
            .|:...:.|..   .||:.         .|.:||      ..:.||.||.||.|...:     ..
Zfish   555 PRSLEDVLGCA---PALSR---------PLLEHL------HCVVVTLGSLGVLVCGEH-----EA 596

  Fly   304 GPVSFEDFRAQR---------------VEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSV 353
            |.|:.:..:.:|               .|:.|:.:||||:|....:...|:......|::|....
Zfish   597 GTVNLQPRKQKRKARLCAVHYPALTLSSEETVNVSGAGDSFAGAMMVGILQGLHTDSCVQMGLLA 661

  Fly   354 AAK 356
            |.:
Zfish   662 ARR 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 79/379 (21%)
PTZ00247 28..366 CDD:240328 79/379 (21%)
zgc:136858NP_001035392.1 Indigoidine_A 33..322 CDD:282130
YeiC_kinase_like 351..668 CDD:238916 79/377 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.