DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and adk

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001016698.1 Gene:adk / 549452 XenbaseID:XB-GENE-997225 Length:361 Species:Xenopus tropicalis


Alignment Length:344 Identity:92/344 - (26%)
Similarity:153/344 - (44%) Gaps:29/344 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARI--- 96
            ||.||| :..:.|...|:::||:...: .|..:|..:|..|..:..:...:.|||..|:.::   
 Frog    29 GNPLLD-ICAVVDKDFLDKYGLKANDQ-ILAEDKHKELFEELVKKFKVEYHAGGSTQNSVKVAQW 91

  Fly    97 -LKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGA 160
             :::....|.|||.:|.||..|.|::...:..::|......:..||.|...:..:|.:|.|::.|
 Frog    92 MIQKPYKVATFFGCIGTDKFGEILKKKAEEAHVDAHYYEQSEQPTGTCAACITGENRSLVAHLAA 156

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..::  ...|....|....   |::.::.|:.|||:....:....:......:.:...:|||||
 Frog   157 ANCYD--KTKHLDLKENWEL---VQKAKVYYIAGFFLTVSPESILKVATQSSEQNKVFCMNLSAP 216

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFRNVD--ELAD--HLLQSGGTK---VIFV 283
            :|.:.....:||:......||||..|....|... ||...|  |:|.  ..||...:|   ::..
 Frog   217 FISQFYKDPLMKVMPYVDILFGNETEAATFAREQ-GFETEDIKEIAKKAQALQKVNSKRPRIVIF 280

  Fly   284 TNGSAGVQVIT-NYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECI 347
            |.|.....|.| |.|        |:|......: .::||..|||||||.|||...:..:.|.||:
 Frog   281 TQGQDDTIVATDNDV--------VAFPVIEIDQ-SKIVDTNGAGDAFVGGFLSQLVSDQPLEECV 336

  Fly   348 RMASSVAAKVVTQVGCNLP 366
            |.....|..|:.:.||..|
 Frog   337 RAGHYSANVVIRRAGCTFP 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 91/342 (27%)
PTZ00247 28..366 CDD:240328 91/342 (27%)
adkNP_001016698.1 ribokinase_pfkB_like 28..361 CDD:381848 92/344 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.