DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and Rbks

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001102173.1 Gene:Rbks / 362706 RGDID:1310064 Length:323 Species:Rattus norvegicus


Alignment Length:351 Identity:79/351 - (22%)
Similarity:131/351 - (37%) Gaps:81/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VICFGNVLLDRLVQLED--PQLLE-----RFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGG 88
            |:..|:.:.| ||.|..  |:..|     :|.:..|.||.....:..:|.|:|:           
  Rat    19 VVVVGSCMTD-LVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAKAA----------- 71

  Fly    89 SALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPT 153
                   ::.::|.|:  ||    :.:.|.|:|  .....|...|| .||.||....::..:...
  Rat    72 -------MVCKVGNDS--FG----NNYIENLKQ--NHISTEFTYQT-RDAATGTASIIVNNEGQN 120

  Fly   154 LYANI-GASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRR 217
            :...: ||:.....:.|..|.        ..:.|.:::..:....|..|      ::.|...|..
  Rat   121 IIVIVAGANLLLNTEDLKKAA--------HVISRAKVMICQLEISPAAS------LEALTMARSS 171

  Fly   218 LALNL--SAPYIVRKNHQAMMKLARAAFFLFG-----NRQEFEALAEAAGGFRNVDELADHLLQS 275
            ....|  .||.|...:.:         |:...     |..|.|.|...|.........|..:|..
  Rat   172 GVKTLFNPAPAIADLDPR---------FYTLSTVFCCNESEAEILTGHAVNDPTTAGTAALVLLE 227

  Fly   276 GGTKVIFVTNGSAGVQVITNYVEELAPPGP--VSFEDFRAQRVEQLVDATGAGDAFVA--GFLHA 336
            .|.:|:.:|.|::|...::.     |.|.|  :..|..:|      ||.|||||:||.  .|..|
  Rat   228 RGCQVVVITLGASGCVTLSQ-----AEPVPKHIPTEAVKA------VDTTGAGDSFVGALAFYLA 281

  Fly   337 WLEKRSLGECIRMASSVAAKVVTQVG 362
            :....||.|.::.::|:||..|...|
  Rat   282 YYPSLSLEEMLKRSNSIAAVSVQATG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 79/351 (23%)
PTZ00247 28..366 CDD:240328 79/351 (23%)
RbksNP_001102173.1 D_ribokin_bact 23..319 CDD:274000 78/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.