DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and CG17010

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_609560.2 Gene:CG17010 / 34650 FlyBaseID:FBgn0032424 Length:429 Species:Drosophila melanogaster


Alignment Length:356 Identity:67/356 - (18%)
Similarity:118/356 - (33%) Gaps:105/356 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTAR 95
            |:.||...::.:..:.          ||...|||       :|....|:  |.   ||...|...
  Fly     7 VVVFGTANIEYITYVP----------ELPKPGEL-------VAGTYMET--CF---GGKGANQCV 49

  Fly    96 ILKQLGTDALFFGAVGADKHAEELRQIIRDRGIE-ARLQTVEDAHTGQCVCLMYQDNPTLYANIG 159
            ...:||...:....:|.|:..::....::...:: ..:|.||:..||.....:.::......|:.
  Fly    50 AAAKLGASTVLVAKLGKDESGDDYLNHLQQHEVDVTHVQQVENNPTGMSEIAVSENGDQYKINVA 114

  Fly   160 ASAQFEVQTLSHAVSHEGQSF--------------------LRPVERKQILYVEGFFVPQRSDVC 204
            .:..|   ..:..|:...:||                    ||..:...:|::.    |.|.|:.
  Fly   115 GANVF---LTAKDVTRAKKSFQDAKVLLCQLETDMNATMCALRQFKGVSLLHMS----PMRKDIP 172

  Fly   205 DYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFRNVDEL- 268
            :.::              ..|.|:..|.                        |||....:::|: 
  Fly   173 NAMI--------------GLPTILVANQ------------------------EAAANLTDMEEVL 199

  Fly   269 -------ADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAG 326
                   |...|.:.|.|.:.:|.|..|...::...:::....|       |..|..|.|.:|||
  Fly   200 TPDQARKAAETLIAKGAKSVIITMGEQGAVYMSKKSKDMCTHVP-------ASDVPHLADPSGAG 257

  Fly   327 DAFVAGFLH--AWLEKRSLGECIRMASSVAA 355
            |||:....:  |...|.|....|..|.|.||
  Fly   258 DAFMGSLAYHIARFPKLSTEHHISAAHSCAA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 67/356 (19%)
PTZ00247 28..366 CDD:240328 67/356 (19%)
CG17010NP_609560.2 ribokinase 6..301 CDD:238579 67/356 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.