DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and SPAC16C9.01c

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_593074.2 Gene:SPAC16C9.01c / 2542315 PomBaseID:SPAC16C9.01c Length:361 Species:Schizosaccharomyces pombe


Alignment Length:322 Identity:61/322 - (18%)
Similarity:113/322 - (35%) Gaps:105/322 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 FGAVGA-----DKHAEELRQIIRDRGI---EARLQTVEDAHTGQCVCLMYQDNPTLYANIGAS-- 161
            |..:||     :..:::|..|: |:|.   :..|..:.|.|||    ::|::.|......|.:  
pombe    39 FALIGARLWTSEPESQQLGMIV-DKGSDFPQVILDELNDLHTG----IVYRETPWRKTTYGYNRL 98

  Fly   162 -----AQFEVQT-------------------LSHAVSHEGQSFLRPVE----------RKQILY- 191
                 ..||..|                   ..|.:::. ::|:...|          |.:|:: 
pombe    99 RDNGFRLFEYLTPKKPIRAPDLLETGLIYAKTIHIITNP-KTFVSVCEELAKYGNLKNRPKIVWE 162

  Fly   192 -------VEGFFVPQRS-DVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGN 248
                   .|.:.:.|:: ..||....:.|.....|.:::|       ..::..|...:||     
pombe   163 PTPESCLPENWHILQKALKYCDIFSPNEVDSANLLGIDIS-------ESKSRAKEFVSAF----- 215

  Fly   249 RQEFEALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQV-----ITNYVEELAPPGPVSF 308
             |||:...::.|.                   :.:.|||.|..:     .||...:...|   ..
pombe   216 -QEFQIGHDSQGW-------------------VVLRNGSDGCLIGACTSSTNATSDAVVP---VR 257

  Fly   309 EDFRAQRVE----QLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCNLP 366
            |......|:    .::|.||||:||....:..:....::.|....|:..|:.|:.|.|  ||
pombe   258 EILHLPSVQMKNGSVLDTTGAGNAFCGAAILEYYRTGNIIEACAKATVAASFVIQQHG--LP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 59/320 (18%)
PTZ00247 28..366 CDD:240328 59/320 (18%)
SPAC16C9.01cNP_593074.2 MAK32 9..341 CDD:238918 61/322 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.