DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and SPBC16G5.02c

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_596751.1 Gene:SPBC16G5.02c / 2539822 PomBaseID:SPBC16G5.02c Length:318 Species:Schizosaccharomyces pombe


Alignment Length:312 Identity:66/312 - (21%)
Similarity:111/312 - (35%) Gaps:84/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TNPGGSALN----TARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEA-RLQTVEDAHTGQC 143
            |..||...|    .||:.....|.....|.||.|....|:...::..|:.. .::.:|:..||..
pombe    37 TGNGGKGANQAVAVARLSNPADTKVSMLGCVGDDAFGVEMLSGLKKDGVNVDNVKKIENKSTGVA 101

  Fly   144 VCLMYQ--DNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDY 206
            :.::.:  :|..|.:. ||:...:.            :|::.:|             ||...|:.
pombe   102 MIIVEETGENRILLSE-GANGNVDT------------AFVKAME-------------QRISTCNL 140

  Fly   207 IVQHL--VRERRRLALNLS-----------AP-------------YIVRKNHQAMMKLARAAFFL 245
            ::..|  ..|...:||.::           ||             |:|...|:|.:.|.:     
pombe   141 LIMQLEIPLEAVEIALQIAHKHGVDVLMNPAPAIPLSHDMISYCAYLVPNEHEAAILLNQ----- 200

  Fly   246 FGNRQEFEALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFED 310
                      |::.....|||..|..||..|..|.:.:|.||.|..    |.........||...
pombe   201 ----------ADSPATLENVDAYASKLLSFGVRKAVIITLGSQGAY----YKSANGESALVSACK 251

  Fly   311 FRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
            .:|      ||.|.|||.|:..|.::....:.|.:.:..|:..:|..|.:.|
pombe   252 VKA------VDTTAAGDTFIGAFSNSIAHGQPLKDSLEFAAKCSAITVQRKG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 66/312 (21%)
PTZ00247 28..366 CDD:240328 66/312 (21%)
SPBC16G5.02cNP_596751.1 D_ribokin_bact 8..309 CDD:274000 66/312 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.