DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and SPBC1861.05

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_596722.1 Gene:SPBC1861.05 / 2539763 PomBaseID:SPBC1861.05 Length:747 Species:Schizosaccharomyces pombe


Alignment Length:380 Identity:72/380 - (18%)
Similarity:144/380 - (37%) Gaps:77/380 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PRKVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEK-----LNQLAAEAS---ESSRCLT 84
            |.:|:|.|:|.:|.:::|::| |..:|   ||:......|:     .:.:|..:|   .|::.::
pombe   390 PAEVVCVGSVSIDSVLKLDNP-LTSKF---LGTSHPCHSEQAFGGVAHNMALASSLMGASTKLVS 450

  Fly    85 NPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRD-------RGIEARL-------QTV 135
            ..|..::.|:.|.:.|...:|....|............|.|       .|.:..:       :..
pombe   451 CVGTKSVPTSSIKEYLTKSSLQHTIVEKSNFTSCSYTAINDCNGNLLLAGADMAIMENLSYSEIK 515

  Fly   136 EDAHTGQCVCLMYQDNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQR 200
            :|.:..:.:|.....:|:|..:|..|...:.:.:....|  |...|:.::...:..:: |..|.:
pombe   516 DDLNDAKYICFDGNISPSLMLDITTSKSSKQRVVFEPTS--GPKTLKILKVLSVASID-FITPNK 577

  Fly   201 SDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKL----ARAAFFLFGNRQEFEALAEAAGG 261
            .:: |.:.|.:....            ..:|.....||    ..::|:     .|.|...::.| 
pombe   578 FEL-DVLFQAMKDGN------------FFENESWWQKLNSFGITSSFY-----NEIERFTKSTG- 623

  Fly   262 FRNVDELAD--------HLLQSGGTKVIFVTNGSAG--------VQVITNYVEELAPPGPVSFED 310
               ::|:.:        |||..  .|.|.|..|..|        :|.:.:....|..||.|:.:.
pombe   624 ---IEEITENGILQKCFHLLPF--IKNIIVKLGPNGALLISSEKLQGVNSNSASLFTPGNVTVKY 683

  Fly   311 FRAQRV-EQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCN 364
            :...:| ...|:|:|.||.|:..|.....:...:.:.|..|...|...:.   ||
pombe   684 YPVPKVIATPVNASGTGDTFIGTFTALLSKGWGMDDAIDTAQKAAGLTLQ---CN 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 72/380 (19%)
PTZ00247 28..366 CDD:240328 72/380 (19%)
SPBC1861.05NP_596722.1 PsuG 31..343 CDD:225195
YeiC_kinase_like 392..734 CDD:238916 69/375 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.