DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and Adk

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_006251693.1 Gene:Adk / 25368 RGDID:2046 Length:403 Species:Rattus norvegicus


Alignment Length:347 Identity:93/347 - (26%)
Similarity:154/347 - (44%) Gaps:35/347 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARI--- 96
            ||.||| :..:.|...|:::.|:...: .|..:|..:|..|..:..:...:.|||..|:.::   
  Rat    71 GNPLLD-ISAVVDKDFLDKYSLKPNDQ-ILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQW 133

  Fly    97 -LKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGA 160
             :::....|.|||.:|.||..|.|:....|..::|......:..||.|...:...|.:|.||:.|
  Rat   134 MIQEPHRAATFFGCIGIDKFGEILKSKAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAA 198

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..::.:  .| :..|....|  ||:.::.|:.|||:....:....:.::.....|...||||||
  Rat   199 ANCYKKE--KH-LDLENNWML--VEKARVYYIAGFFLTVSPESVLKVARYAAENNRTFTLNLSAP 258

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELADHL-----LQSGGTKVIFVT 284
            :|.:...:|:|::......||||..|....|...| ..:::.|:|...     :.|...:.:..|
  Rat   259 FISQFFKEALMEVMPYVDILFGNETEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFT 323

  Fly   285 NGSAGVQVITNYVEELAPPGPVSFEDFRA-----QRVEQLVDATGAGDAFVAGFLHAWLEKRSLG 344
            .|.....|.|.             .|..|     |..|::||..|||||||.|||...:..:.|.
  Rat   324 QGRDDTIVATG-------------NDVTAFPVLDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLT 375

  Fly   345 ECIRMASSVAAKVVTQVGCNLP 366
            ||||.....|:.::.:.||..|
  Rat   376 ECIRAGHYAASVIIRRTGCTFP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 92/345 (27%)
PTZ00247 28..366 CDD:240328 92/345 (27%)
AdkXP_006251693.1 PTZ00247 60..402 CDD:240328 93/347 (27%)
ribokinase_pfkB_like 70..402 CDD:294126 93/347 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226324at2759
OrthoFinder 1 1.000 - - FOG0003751
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100649
Panther 1 1.100 - - LDO PTHR45769
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2162
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.