DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and Khk

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001297453.1 Gene:Khk / 16548 MGIID:1096353 Length:343 Species:Mus musculus


Alignment Length:399 Identity:74/399 - (18%)
Similarity:134/399 - (33%) Gaps:141/399 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RKVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLT---NPGGSA 90
            ::::|.|.|:||.:      .:::::                   .|.....|||:   ..||:|
Mouse     4 KQILCVGLVVLDII------NVVDKY-------------------PEEDTDRRCLSQRWQRGGNA 43

  Fly    91 LNTARILKQLGTDALFFGAVG----AD-------KHAEELRQII--------------------- 123
            .|:..:|..||....|.|::.    ||       :|:.:||.::                     
Mouse    44 SNSCTVLSLLGARCAFMGSLAPGHVADFVLDDLRQHSVDLRYVVLQTEGSIPTSTVIINEASGSR 108

  Fly   124 -------------RDRGIEARLQTVEDAHTGQCVC------------LMYQDN-PTLYANIGASA 162
                         |.||::....|.:......|.|            ::|..| |.:.|.     
Mouse   109 TILHAYSFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNSNGSRTIILYDTNLPDVSAK----- 168

  Fly   163 QFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAPYI 227
            .||...|:               |.:.:::||....::..:...|.:|..::.....:.:|..  
Mouse   169 DFEKVDLT---------------RFKWIHIEGRNASEQVKMLQRIEEHNAKQPLPQKVRVSVE-- 216

  Fly   228 VRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFRNVDELADHLLQSGGTKVIFVTNG-----S 287
            :.|..:.:.:|......:|.::                 ::|.||   |....:....|     .
Mouse   217 IEKPREELFQLFSYGEVVFVSK-----------------DVAKHL---GFQSAVEALRGLYSRVK 261

  Fly   288 AGVQVITNYVEE----LAPPGPVSFED-FRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECI 347
            .|..::..:.||    |.|.|.:...| |...||   ||..||||.|.|..:.:..:..|:.|.:
Mouse   262 KGATLVCAWAEEGADALGPDGQLLHSDAFPPPRV---VDTLGAGDTFNASVIFSLSKGNSMQEAL 323

  Fly   348 RMASSVAAK 356
            |....||.|
Mouse   324 RFGCQVAGK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 74/399 (19%)
PTZ00247 28..366 CDD:240328 74/399 (19%)
KhkNP_001297453.1 Ketohexokinase 5..340 CDD:238914 74/398 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.