DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and PML1

DIOPT Version :9

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_013116.1 Gene:PML1 / 850703 SGDID:S000004006 Length:204 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:19/94 - (20%)
Similarity:41/94 - (43%) Gaps:16/94 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KDDKLVQKLMVDEKRCYLFGR------NSQMN--------DFCIDHASCSRVHSAFVYHKHLNI- 73
            ||....::..::.:.|||.||      ::.::        |..|...:.|:.|....:.....| 
Yeast    88 KDKGPWKRYDLNGRSCYLVGRELGHSLDTDLDDRTEIVVADIGIPEETSSKQHCVIQFRNVRGIL 152

  Fly    74 -AYLVDLGSTHGTFIGTLRLEAHKPTQLQ 101
             .|::||.|::||.:..:.:...:..:|:
Yeast   153 KCYVMDLDSSNGTCLNNVVIPGARYIELR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 19/94 (20%)
FHA <40..>87 CDD:224630 15/62 (24%)
PML1NP_013116.1 FHA 85..192 CDD:238017 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.