DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and AT5G38840

DIOPT Version :9

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_198700.2 Gene:AT5G38840 / 833875 AraportID:AT5G38840 Length:735 Species:Arabidopsis thaliana


Alignment Length:409 Identity:96/409 - (23%)
Similarity:158/409 - (38%) Gaps:111/409 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYHK 69
            |.||.|:|.|.....|:|||:..:|:||.|.:|..|||||:. :.||.::|.|.||.| |.:.:|
plant    90 YTIPEWSGPPCHQFQLEVLKEGAIVEKLDVYKKGAYLFGRDG-ICDFALEHPSISRFH-AVIQYK 152

  Fly    70 HLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYI------------------ 116
            ....||:.||||||||.:...:::......|.:.....||.|||.||                  
plant   153 RSGAAYIFDLGSTHGTTVNKNKVDKKVFVDLNVGDVIRFGGSTRLYIFQGPSDLMPPEKDLQLIR 217

  Fly   117 ---LRERPSGHHSNIMEDLPLSETSDGALLGLPES--QTELDNLTE--YNTAHN----------- 163
               :|...|...:::......:..:||...|:.|.  :.|.|::.|  :.|...           
plant   218 EAKMRMEMSEREASLRRARQQASMADGVSWGMGEDAIEEEEDDVEEITWQTYSGELTPKQEKTKE 282

  Fly   164 ---RRISMLGIDDDTNMRK-----------QNALKQGRRTRNVTFNDEEIVINPEDVDPNVGRFR 214
               :|:..:|     :|:|           |..|.||::|: :..|::......|:::       
plant   283 KVLKRLEKIG-----HMKKEVAAIRAKDISQGGLTQGQQTQ-IARNEQRTAELLEELE------- 334

  Fly   215 NLVQT------TVVPAKRARCDVN--HMGIHSGNSSLS--------------SANAAHVHQMFQ- 256
            ||.:|      ..:.||..|...:  ..||......||              |......:|..: 
plant   335 NLEETLNDSIRESLGAKTGRKPTHGKKKGIVEDEEDLSSDEDDFYDRTQKKPSTKKGSENQTVET 399

  Fly   257 -QSLVDMKQQ-HREMPPPNAVLHSPTNSLYQGLPAEMHGKGDLEPISPLSIGSKLGLLLPNPAPE 319
             .||||.:.. .:|:...|..|.:..:            |.:.|.::.::.|..|         :
plant   400 VDSLVDKRDNVLKEIEAKNEQLLTEKS------------KMETENVTEVTSGDSL---------D 443

  Fly   320 VLPVYDEAVETSTLAQKLA 338
            .|..|...:.|:.:..|.|
plant   444 ALDAYMTGLSTTLVQDKTA 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 35/91 (38%)
FHA <40..>87 CDD:224630 24/46 (52%)
AT5G38840NP_198700.2 FHA 103..201 CDD:238017 41/99 (41%)
PTZ00108 <280..602 CDD:240271 39/217 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.