DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and DDL

DIOPT Version :9

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_188691.1 Gene:DDL / 821601 AraportID:AT3G20550 Length:314 Species:Arabidopsis thaliana


Alignment Length:139 Identity:45/139 - (32%)
Similarity:65/139 - (46%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDIPSWAGKPPTGLHLDVLKD-DKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYH 68
            ::.|..|.||.....|.|.|| :.|.:.|.:..:.||||||..::.|...||.|||:.|:...|.
plant   183 FNEPPEARKPSERWRLYVFKDGEPLNEPLCLHRQSCYLFGRERRIADIPTDHPSCSKQHAVIQYR 247

  Fly    69 ------------KHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERP 121
                        |.:. .|::|||||:.|:|....:|..:..:|....|..||.|:|.|:|.   
plant   248 EMEKEKPDGMMGKQVK-PYIMDLGSTNKTYINESPIEPQRYYELFEKDTIKFGNSSREYVLL--- 308

  Fly   122 SGHHSNIME 130
               |.|..|
plant   309 ---HENSAE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 33/104 (32%)
FHA <40..>87 CDD:224630 21/58 (36%)
DDLNP_188691.1 FHA 195..302 CDD:238017 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.