DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and AT2G24410

DIOPT Version :10

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_180017.1 Gene:AT2G24410 / 816977 AraportID:AT2G24410 Length:78 Species:Arabidopsis thaliana


Alignment Length:37 Identity:13/37 - (35%)
Similarity:19/37 - (51%) Gaps:1/37 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPTGLHLDVLKD-DKLVQKLMVDEKRCYLFGRNSQM 48
            ||.....|...|| :.|.:.|.:..:.||||||..::
plant    38 KPKERWRLYHFKDGEPLKETLCIHYQICYLFGRERKI 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA_PPP1R8 12..119 CDD:438726 13/37 (35%)
AT2G24410NP_180017.1 FHA 10..>74 CDD:469597 13/35 (37%)

Return to query results.
Submit another query.