DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and SNIP1

DIOPT Version :9

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_078976.2 Gene:SNIP1 / 79753 HGNCID:30587 Length:396 Species:Homo sapiens


Alignment Length:159 Identity:43/159 - (27%)
Similarity:72/159 - (45%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYH- 68
            |..|..|..|.....|...|:|:::..:.:..:..||.||:.::.|..|||.|||:.|:.|.|. 
Human   246 YSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRL 310

  Fly    69 -----------KHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPS 122
                       :.:. .|::||||.:|||:...|:|..:..:|:......||.|:|.|:|     
Human   311 VEYTRADGTVGRRVK-PYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVL----- 369

  Fly   123 GHHSNIMEDLPLSETSDGALLGLPESQTE 151
                       |.|:||.:.:...:.:.|
Human   370 -----------LHESSDTSEIDRKDDEDE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 29/103 (28%)
FHA <40..>87 CDD:224630 21/58 (36%)
SNIP1NP_078976.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..227
PRK12678 24..>208 CDD:237171
FHA 258..361 CDD:238017 28/103 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..396 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.