DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and Snip1

DIOPT Version :10

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_780455.2 Gene:Snip1 / 76793 MGIID:2156003 Length:383 Species:Mus musculus


Alignment Length:147 Identity:43/147 - (29%)
Similarity:69/147 - (46%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFVYH- 68
            |..|..|..|.....|...|:|:::..:.:..:..||.||:.::.|..|||.|||:.|:.|.|. 
Mouse   233 YSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYRL 297

  Fly    69 -----------KHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERPS 122
                       :.:. .|::||||.:|||:...|:|..:..:|:......||.|:|.|:|.    
Mouse   298 VEYTRADGTVGRRVK-PYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGFSSREYVLL---- 357

  Fly   123 GHHSNIMEDLPLSETSD 139
             |.|:...:|...|..|
Mouse   358 -HESSDTSELDRKEDED 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA_PPP1R8 12..119 CDD:438726 35/118 (30%)
Snip1NP_780455.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..209
PRK12678 2..>189 CDD:237171
FHA_SNIP1 211..359 CDD:438770 38/131 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..383 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.