DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and CG7706

DIOPT Version :9

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_650742.2 Gene:CG7706 / 42244 FlyBaseID:FBgn0038640 Length:726 Species:Drosophila melanogaster


Alignment Length:206 Identity:48/206 - (23%)
Similarity:78/206 - (37%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDIPSWAGKPPTG--LHLDVLKDDKLVQKL-MVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFV 66
            |.:|.|:..|...  ...:|||..:::..: .:.::..:.|||..: ||....|.:.||.|....
  Fly    50 YKVPKWSAPPAENQIYSFEVLKSGQIIDTVHQLQQQAVWTFGRLPE-NDVPAAHPTISRFHVVLQ 113

  Fly    67 Y-------------------------HKHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTF 106
            |                         :......|:.|:|||||||:...|:......::::....
  Fly   114 YKPKAPPKPETAKEDDEMEEEDEEPKNDQPEGWYIYDMGSTHGTFLNKQRVPPKVYIRMRVGHML 178

  Fly   107 HFGASTRNYILR-----ERPSGHHS-NIMEDLPLSETSDGALLGLPESQTELDNLTEYNTAHNRR 165
            ..|.|||.|||:     |.|....| ..:......|.:|.|:      :.||..|.......|..
  Fly   179 KLGGSTRVYILQGPGEDEEPESELSVTELRQKREKELADAAV------ERELRLLEAEERERNEG 237

  Fly   166 ISMLGIDDDTN 176
            :|. |:.||.:
  Fly   238 VSW-GMGDDAD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 23/117 (20%)
FHA <40..>87 CDD:224630 18/71 (25%)
CG7706NP_650742.2 FHA 69..190 CDD:238017 29/121 (24%)
FHA <84..215 CDD:224630 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23308
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.