DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and Slc4a1ap

DIOPT Version :9

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_038967837.1 Gene:Slc4a1ap / 298805 RGDID:1307080 Length:738 Species:Rattus norvegicus


Alignment Length:210 Identity:62/210 - (29%)
Similarity:92/210 - (43%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANSYDIPSWAGKPPTGLH-LDVLKDDKLV-QKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSA 64
            |..|..||| |.|.|..: |:.||...:: .:.:.|...| ||||.:.. |.|::|.|.||.| |
  Rat    97 APPYQEPSW-GSPATAPYSLETLKGGTILGTRTLKDTSYC-LFGRLASC-DICLEHPSVSRYH-A 157

  Fly    65 FVYHKHLNIA----------YLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRE 119
            .:.|:..:.:          ||.|||||||||:...|:......::.:.....||.|||.:||: 
  Rat   158 VLQHRGSDPSGDSEDQGQGFYLYDLGSTHGTFLNKTRIPPRTYCRVHVGHVIRFGGSTRLFILQ- 221

  Fly   120 RPSGHHSNIMEDLPLSETSDGALLGLPESQTELDNLTEYNTAHNRRISMLGIDDDTNMRKQNALK 184
               |...:...:..|:.|.      |.|.:.:...|.|.        .|||.|.|    :::...
  Rat   222 ---GPEEDREAESELTVTQ------LKELRKQQQALLEK--------KMLGEDSD----EEDEAD 265

  Fly   185 QGRRTRNVTFNDEEI 199
            .....||.:..|||:
  Rat   266 TTAGKRNTSGQDEEM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 31/103 (30%)
FHA <40..>87 CDD:224630 23/56 (41%)
Slc4a1apXP_038967837.1 minC <12..>121 CDD:178806 11/24 (46%)
FHA 113..221 CDD:238017 36/110 (33%)
DSRM_Kanadaptin 309..391 CDD:380685
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.