DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NiPp1 and SLC4A1AP

DIOPT Version :9

Sequence 1:NP_611177.1 Gene:NiPp1 / 44748 FlyBaseID:FBgn0026402 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_060628.3 Gene:SLC4A1AP / 22950 HGNCID:13813 Length:742 Species:Homo sapiens


Alignment Length:229 Identity:64/229 - (27%)
Similarity:90/229 - (39%) Gaps:36/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANSYDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSAFV 66
            |..|..|.|.|.......|:.||...::....:......||||.|.. |.|::|.|.||.| |.:
Human    97 APPYQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGC-DVCLEHPSVSRYH-AVL 159

  Fly    67 YHKHLNI----------AYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGASTRNYILRERP 121
            .|:....          .||.|||||||||:...|:......::.:.....||.|||.:||:   
Human   160 QHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTYCRVHVGHVVRFGGSTRLFILQ--- 221

  Fly   122 SGHHSNIMEDLPLSETSDGALLGLPESQTELDNLTEYNTAHNRRISMLGIDD------DTNMRKQ 180
             |...:...:..|:.|.      |.|.:.:...|.|.        .|||.|.      ||:.||.
Human   222 -GPEEDREAESELTVTQ------LKELRKQQQILLEK--------KMLGEDSDEEEEMDTSERKI 271

  Fly   181 NALKQGRRTRNVTFNDEEIVINPEDVDPNVGRFR 214
            ||..|...........|:.|.:..:.:|.|..|:
Human   272 NAGSQDDEMGCTWGMGEDAVEDDAEENPIVLEFQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NiPp1NP_611177.1 FHA 18..110 CDD:238017 30/101 (30%)
FHA <40..>87 CDD:224630 24/56 (43%)
SLC4A1APNP_060628.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.