DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msk and SKIV2L

DIOPT Version :9

Sequence 1:NP_524780.1 Gene:msk / 44747 FlyBaseID:FBgn0026252 Length:1049 Species:Drosophila melanogaster
Sequence 2:NP_008860.4 Gene:SKIV2L / 6499 HGNCID:10898 Length:1246 Species:Homo sapiens


Alignment Length:832 Identity:152/832 - (18%)
Similarity:278/832 - (33%) Gaps:257/832 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 YGSPSNVVSEKYQKFAEWYLPTFSQ-GVL----------EVLLKILDQYRNRVYVSPRVLTDV-- 327
            |.||...:|.  |||.: :..||.. |:|          ..|:...:..|:.:|....|:.|:  
Human   358 YTSPIKALSN--QKFRD-FRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEW 419

  Fly   328 -----LNYLKNAVSHAYTWK----LIKPHMVAVIQDVIFP-IMSFTDSDQELWESDPYEYIRLK- 381
                 ::|: |.|.....|:    ::..|:..::.....| .:.|.|     |..      ||| 
Human   420 VIFDEVHYI-NDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFAD-----WIG------RLKR 472

  Fly   382 --FDIFEDYATPVPAAQSLLHSMCKKRKGILPKAMATIMQIITSPNADNKQKDGALHMIGTLADV 444
              ..:......|||....|......|.:|.|...:            |::   ||.|..|..|.|
Human   473 RQIYVISTVTRPVPLEHYLFTGNSSKTQGELFLLL------------DSR---GAFHTKGYYAAV 522

  Fly   445 LLKKASYRDQVESMLTTYVFPEFQNPAGHMRARACWVLHYFCDVQIKNPQVLAEIMRLTTNALLT 509
            ..||    :::.....|:...:..:..|..:.|..::            .:||        :|.|
Human   523 EAKK----ERMSKHAQTFGAKQPTHQGGPAQDRGVYL------------SLLA--------SLRT 563

  Fly   510 DKELPVKVEAAIGLQMFISSQDEAPQYVEAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQ 574
            ..:|||.|        |..|:....:....         ||.:      |||...:|        
Human   564 RAQLPVVV--------FTFSRGRCDEQASG---------LTSL------DLTTSSEK-------- 597

  Fly   575 LLPVATEICQHLATTFSQVLESEEGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVV 639
                 :||  ||  ...:.|....|||.:....:.:...:...|.|  .|..:|    ||:..:|
Human   598 -----SEI--HL--FLQRCLARLRGSDRQLPQVLHMSELLNRGLGV--HHSGIL----PILKEIV 647

  Fly   640 GHIFQHNITD--FYEETFSLVYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTV 702
            ..:|...:..  |..|||::..::.|:.:          ::...:|.....|.|::|.  .||.:
Human   648 EMLFSRGLVKVLFATETFAMGVNMPARTV----------VFDSMRKHDGSTFRDLLPG--EYVQM 700

  Fly   703 DTPA----------------------------FLSNPNRLLAILDMCKTMLTSSPGEDPECHAAK 739
            ...|                            .:..|::|.:...:..||:.:....| ......
Human   701 AGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVD-ALRVED 764

  Fly   740 LMEVIILQCKGQIDSVIHMFVELALSRLTREVQSSELRTMCLQVVIAALYYNPQLLLSILDKMSQ 804
            :|:....:...:.||..|   |.||:.||:.:.:.|...|..|:|....||      |..:::::
Human   765 MMKRSFSEFPSRKDSKAH---EQALAELTKRLGALEEPDMTGQLVDLPEYY------SWGEELTE 820

  Fly   805 QNNDSISAHFIKQWLHDTDCFLGIHDRKLCVLGLCTLI-------SLGEAKPQVLSEVAGKIVPA 862
                  :.|.|::.:.::     ::..|....|...::       :||... ||.|....::...
Human   821 ------TQHMIQRRIMES-----VNGLKSLSAGRVVVVKNQEHHNALGVIL-QVSSNSTSRVFTT 873

  Fly   863 LILLFDGLKRAYESRAQEEEEDEEEEDGDDCEEALSSDEDDMDEMAPD--YLDKLAEFAKTKGNE 925
            |:|                           |::.||.|..|......:  |.|.|.         
Human   874 LVL---------------------------CDKPLSQDPQDRGPATAEVPYPDDLV--------- 902

  Fly   926 SGFEVKAEIKDDDADSDGDAEESVGDLNETGLESFTTPIDDEENESAIDEYW-----TFKE--VI 983
             ||::..        .:|..:.:|..|....:.:.||.:.....|..::::.     .||:  .:
Human   903 -GFKLFL--------PEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPL 958

  Fly   984 TALSAQDQAWYALLTSN------LTPEQAKALQEVVVTADQRKAAKESKLIE 1029
            .|::...|....|..::      |.|.....|:::.|.....:|.|..:||:
Human   959 AAVTTAVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVEGGLRARKLEELIQ 1010

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mskNP_524780.1 SXM1 4..1013 CDD:227943 147/814 (18%)
IBN_N 24..103 CDD:281761
SKIV2LNP_008860.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..246
Dob10 280..1244 CDD:333050 152/832 (18%)
DEVH box 423..426 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4581
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.