DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment msk and Mtr4

DIOPT Version :9

Sequence 1:NP_524780.1 Gene:msk / 44747 FlyBaseID:FBgn0026252 Length:1049 Species:Drosophila melanogaster
Sequence 2:NP_524929.1 Gene:Mtr4 / 48782 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster


Alignment Length:661 Identity:117/661 - (17%)
Similarity:210/661 - (31%) Gaps:264/661 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 PLNEAMNLLLPMIYQLMVRLLAEQSEQSVLLQKQILK---------IYYALTQYTLPLDLIT--- 223
            |:|.|.:|...|:..|   |..|:.....:|::...:         ::..:.|.||.|:.:|   
  Fly   574 PINSAFHLTYNMVLNL---LRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKD 635

  Fly   224 KEIFSQWMEICRQVADRAVPDSSHLDDDERTEFPYWKTK-KWALHIMVRMFERYGSPSNVV---- 283
            :...:.:..|..|:            |....:|..|.|| ::.|..:        .|..:|    
  Fly   636 EHNIASYHHIRSQL------------DQHGKQFRQWITKPQYLLPFL--------QPGRLVKVAA 680

  Fly   284 -SEKYQKFAEWYLPTFSQGVLEVLLKILDQYR-NRVYVSPRVLTDVLNYLKNAVSHAYTWKLIKP 346
             |::|    :|       |:: :..|..||.| |.:...|.|..|||.::..|.:.....:..||
  Fly   681 GSQEY----DW-------GIV-LNFKKQDQSRKNPLKAEPSVTIDVLLHVSEAAAKTGDTEPCKP 733

  Fly   347 HMVAVIQDVIFPIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRKGILP 411
            :....::                                     .||.|.:|:..:...|     
  Fly   734 NERGCME-------------------------------------VVPVAHTLITQISSIR----- 756

  Fly   412 KAMATIMQIITSPN----ADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEFQNPAG 472
                     :..||    |||::                          ::|.|....:.:.|.|
  Fly   757 ---------VYFPNDLRSADNRR--------------------------AVLKTIQEAKKRFPLG 786

  Fly   473 HMRARACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFISSQDEAPQYV 537
            ..      ||:...|:.||                  |:|....|..   :..|....:|.|.:.
  Fly   787 PP------VLNPIDDMNIK------------------DREFRDIVNT---ISQFEKRLEEHPLHK 824

  Fly   538 EAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLATTFSQVLESEEGSDE 602
            ..:::.|.:               ....|:  |..:||..:..|:                    
  Fly   825 SPELERIHR---------------RYQDKV--TLQKQLQDLKAEL-------------------- 852

  Fly   603 KAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNITDFYEETFSLVYDLTAKAIS 667
            ||  |.|||.        |:|     |.....|:..:|:....::.:|...       :..:..|
  Fly   853 KA--ARSLLQ--------MDE-----LKHRKRVLRRMGYCKPGDVIEFKGR-------VACELSS 895

  Fly   668 PEMWQMLELIYQVFKKDGIDYFIDI-----MPALHNYV-------TVDTPAFLSNP--------N 712
            .:...|.|:|:     :|:  |.|:     :..|..:|       :|.:...||.|        .
  Fly   896 ADELLMTEMIF-----NGV--FNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLAR 953

  Fly   713 RLLAILDMCKTMLTSSPGEDPECHAAK----LMEVIILQCKGQ----IDSVIHMFVELALSRLTR 769
            |:..:...||..|      |.:.:..|    ||:|::..|||.    :..:..:| |.::.|..|
  Fly   954 RIAKVSTECKLDL------DADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIF-EGSIIRCMR 1011

  Fly   770 EVQSSELRTMC 780
            .::.. ||.||
  Fly  1012 RLEEL-LRQMC 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mskNP_524780.1 SXM1 4..1013 CDD:227943 117/661 (18%)
IBN_N 24..103 CDD:281761
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 117/661 (18%)
DEAD 154..299 CDD:278688
HELICc 390..554 CDD:238034
rRNA_proc-arch 600..853 CDD:289976 64/425 (15%)
DSHCT 881..1048 CDD:285374 34/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4581
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.