DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and TXNL1

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:XP_024307057.1 Gene:TXNL1 / 9352 HGNCID:12436 Length:292 Species:Homo sapiens


Alignment Length:87 Identity:27/87 - (31%)
Similarity:40/87 - (45%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IVNFHAEWCDPCKILTPKMLELLENSNEIDLAV---IDVETNLDLVETFEVKAVPAVLAFRNGVV 132
            :|.|....|.||..:.|....:   ||:...||   :||........|..:.|.|..|.|||.|.
Human    26 VVKFTMRGCGPCLRIAPAFSSM---SNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVR 87

  Fly   133 VDKFIGLVDANSIETLIDKLKR 154
            :|::.| .||..:|   :|:|:
Human    88 IDQYQG-ADAVGLE---EKIKQ 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 25/81 (31%)
TXNL1XP_024307057.1 TRX_family 12..104 CDD:239245 26/84 (31%)
PITH 128..268 CDD:399305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.