DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and TRX1

DIOPT Version :10

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_013144.1 Gene:TRX1 / 850732 SGDID:S000004033 Length:103 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:31/81 - (38%)
Similarity:47/81 - (58%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVIDVETNLDLVETFEVKAVP 122
            ||| ..|..|..|:|:|:|.||.|||::.|.:.:..|...:.|...:||:...|:.:..||.|:|
Yeast    10 EFD-SAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMP 73

  Fly   123 AVLAFRNGVVVDKFIG 138
            .:|.|:||..|.|.:|
Yeast    74 TLLLFKNGKEVAKVVG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 CnoX 58..150 CDD:442352 31/81 (38%)
TRX1NP_013144.1 thioredoxin 6..103 CDD:200072 31/81 (38%)

Return to query results.
Submit another query.