DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and TY1

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_177802.2 Gene:TY1 / 844010 AraportID:AT1G76760 Length:172 Species:Arabidopsis thaliana


Alignment Length:99 Identity:32/99 - (32%)
Similarity:59/99 - (59%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELLEN-SNEIDLAVIDVETNLDLVETFEVKAVP 122
            |:..::|||.||:|:::|.||.||:.:.|.:.|:.|. .::|.:..||.|....:...::::|:|
plant    73 FEDLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALP 137

  Fly   123 AVLAFRNGVVVDKFIGLVDANS-IETLIDKLKRK 155
            ..:.|::|...|:|.|.:.|.. |:.:.|.||.|
plant   138 TFILFKDGEPCDRFEGALTAKQLIQRIEDSLKVK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 28/92 (30%)
TY1NP_177802.2 Thioredoxin_like 69..168 CDD:412351 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2414
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.