DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and TH7

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_176182.1 Gene:TH7 / 842266 AraportID:AT1G59730 Length:129 Species:Arabidopsis thaliana


Alignment Length:93 Identity:25/93 - (26%)
Similarity:49/93 - (52%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SDNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNG 130
            |:..::::|.|.||.|||.:.|::.|:....:|...|.:||:..:|:..|:....:||.:..:.|
plant    42 SNKLLVIDFTAVWCGPCKAMEPRVREIASKYSEAVFARVDVDRLMDVAGTYRAITLPAFVFVKRG 106

  Fly   131 VVVDKFIGLVDANSIETLIDKLKRKQQQ 158
            ..:|:.:|...        |:|.:|.:|
plant   107 EEIDRVVGAKP--------DELVKKIEQ 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 21/83 (25%)
TH7NP_176182.1 TRX_family 36..125 CDD:239245 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.