DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and AT1G52990

DIOPT Version :10

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_564620.1 Gene:AT1G52990 / 841732 AraportID:AT1G52990 Length:313 Species:Arabidopsis thaliana


Alignment Length:90 Identity:27/90 - (30%)
Similarity:45/90 - (50%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 INSDNP-VIVNFHAEWCDPCKILTPKMLEL-LENSNEIDLAVIDVETNLDLVETFEVKAVPAVLA 126
            :||..| |:|.|.|.||.||:.:.|.:.:: .|..||.....::.:|.:...|.|::..:|..|.
plant   223 LNSQTPHVMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLV 287

  Fly   127 FRNGVVVDKFIGLVDANSIETLIDK 151
            |:.|..:.|..| .|...:..|:.|
plant   288 FKGGEQMAKVTG-ADPKKLRELVKK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 CnoX 58..150 CDD:442352 26/87 (30%)
AT1G52990NP_564620.1 RVT_3 51..172 CDD:433223
CnoX 223..313 CDD:442352 27/90 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.