DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and THX

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_564566.1 Gene:THX / 841454 AraportID:AT1G50320 Length:182 Species:Arabidopsis thaliana


Alignment Length:149 Identity:43/149 - (28%)
Similarity:70/149 - (46%) Gaps:9/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IAPRLAAACCSIGAKSRGQRMAPQAARGTQKYLSQSQHLHKMLVIKD--HYEFDQKVINSDNPVI 71
            :.|..:....|:.| :|........||.|:|   .|..:.:...||:  ..||...|:.|..||:
plant    31 VKPLSSVQVTSVAA-NRHLLSLSSGARRTRK---SSSSVIRCGGIKEIGESEFSSTVLESAQPVL 91

  Fly    72 VNFHAEWCDPCKILTPKMLEL-LENSNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVV-- 133
            |.|.|.||.|||::.|.|..| .|..:::.:..||.:.|..|:..|:|..:|..:.|::|..|  
plant    92 VEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFKDGKEVPG 156

  Fly   134 DKFIGLVDANSIETLIDKL 152
            .:..|.:....::..||.|
plant   157 SRREGAITKAKLKEYIDGL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 29/94 (31%)
THXNP_564566.1 Thioredoxin_like 76..176 CDD:412351 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.