DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and ty2

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_175021.2 Gene:ty2 / 840939 AraportID:AT1G43560 Length:167 Species:Arabidopsis thaliana


Alignment Length:144 Identity:43/144 - (29%)
Similarity:76/144 - (52%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SIGAKSRGQRMAPQAARGTQKYLSQSQHLHKMLVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCK 83
            |:.:.|...|.||...|..:|....|              ||..:.|||.||:|:|:|.||.||:
plant    42 SVQSPSSSTRFAPLTVRAAKKQTFNS--------------FDDLLQNSDKPVLVDFYATWCGPCQ 92

  Fly    84 ILTPKMLELLENSNEIDLAVIDVETNL--DLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIE 146
            ::.|.:.|:.|...:| :||:.::|..  .|...::::|:|..:.|::|.:.|:|.|.:.||.  
plant    93 LMVPILNEVSETLKDI-IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQ-- 154

  Fly   147 TLIDKLKRKQQQKQ 160
             |:::::...|.||
plant   155 -LVERIENSLQVKQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 32/93 (34%)
ty2NP_175021.2 Thioredoxin_like 64..163 CDD:412351 33/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2414
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.