DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and ACHT4

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_172333.1 Gene:ACHT4 / 837379 AraportID:AT1G08570 Length:275 Species:Arabidopsis thaliana


Alignment Length:73 Identity:17/73 - (23%)
Similarity:36/73 - (49%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QKVINS-----DNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVIDVETNLDLVETFEVKA 120
            |::::|     |..|:|:|.:..|..||.|.||:.:..|.:.::....::.|.:..:..:..|..
plant   106 QELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQFAEMNPDVQFLQVNYEEHKSMCYSLGVHV 170

  Fly   121 VPAVLAFR 128
            :|....:|
plant   171 LPFFRFYR 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 17/73 (23%)
ACHT4NP_172333.1 TRX_family 115..202 CDD:239245 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43601
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.