DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and ATHM2

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_192261.1 Gene:ATHM2 / 825653 AraportID:AT4G03520 Length:186 Species:Arabidopsis thaliana


Alignment Length:147 Identity:32/147 - (21%)
Similarity:76/147 - (51%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AEGIAPRLAAACCSIGAKSRGQRMAPQAARGTQKYLSQSQHLHKMLVIKDHYEFDQKVINSDNPV 70
            :.|:..||:.:..|:.:..:     |:.:|..:..:.::|.....:.:.:...:|..|:.:..||
plant    42 SSGLRIRLSLSPASLTSIHQ-----PRVSRLRRAVVCEAQETTTDIQVVNDSTWDSLVLKATGPV 101

  Fly    71 IVNFHAEWCDPCKILTPKMLELLEN-SNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVD 134
            :|:|.|.||.|||::.|.:.:|.:: :.:|....::.:.:.:....:.|:::|.::.|..|...|
plant   102 VVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFVGGEKKD 166

  Fly   135 KFIGLVDANSIETLIDK 151
            ..||.|...::.:.:||
plant   167 TIIGAVPKTTLTSSLDK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 23/92 (25%)
ATHM2NP_192261.1 thioredoxin 85..185 CDD:200072 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.