DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and TRX-M4

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_188155.1 Gene:TRX-M4 / 820775 AraportID:AT3G15360 Length:193 Species:Arabidopsis thaliana


Alignment Length:150 Identity:41/150 - (27%)
Similarity:71/150 - (47%) Gaps:24/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LAAACCSIGAK-----SRGQRMAPQAARGTQ-----KYLSQSQHLHKMLVIKDHYEFDQKVINSD 67
            |.....|:||.     :||.|:|.:|...|.     ..||.|             |:..||:.||
plant    53 LVTQSASLGANRRTRIARGGRIACEAQDTTAAAVEVPNLSDS-------------EWQTKVLESD 104

  Fly    68 NPVIVNFHAEWCDPCKILTPKMLELLEN-SNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGV 131
            .||:|.|.|.||.||:::.|.:.:|.:: :.:.....|:.:.:.:....:.:::||.|:.|:.|.
plant   105 VPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGE 169

  Fly   132 VVDKFIGLVDANSIETLIDK 151
            ..|..||.|...::|..|::
plant   170 KKDSIIGAVPRETLEKTIER 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 27/92 (29%)
TRX-M4NP_188155.1 thioredoxin 91..191 CDD:200072 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.