powered by:
Protein Alignment CG3719 and AT3G04780
DIOPT Version :9
Sequence 1: | NP_651990.1 |
Gene: | CG3719 / 44736 |
FlyBaseID: | FBgn0024986 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_566238.1 |
Gene: | AT3G04780 / 819638 |
AraportID: | AT3G04780 |
Length: | 176 |
Species: | Arabidopsis thaliana |
Alignment Length: | 70 |
Identity: | 14/70 - (20%) |
Similarity: | 29/70 - (41%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 PKMLELLENSNEIDLAVIDVETNLDLVETFE--VKAVPAVLAFRNGVVVDKFIGLVDANSIETLI 149
||.::...|...:..:.::.....|..|..| :|..|.||.:.....|......::||...:.:
plant 85 PKTVKFFSNKEHMCFSNVNDFPPSDTAELTEENLKGKPVVLKYVKFQNVRSLTIFIEANQSGSEV 149
Fly 150 DKLKR 154
.|:::
plant 150 TKVQK 154
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.