DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and Txn2

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_445783.1 Gene:Txn2 / 79462 RGDID:71040 Length:166 Species:Rattus norvegicus


Alignment Length:129 Identity:49/129 - (37%)
Similarity:80/129 - (62%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PQAARGTQKYLSQSQHLHKMLV------IKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKM 89
            |..|.|.....|.::..|...|      ::|..:|..:|:||:.||:|:|||:||.|||||.|::
  Rat    36 PYNAGGLTGTPSPARTFHTTRVCSTTFNVQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRL 100

  Fly    90 LELL-ENSNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKL 152
            .::: :...::.:|.:|::.:.||...:||.|||.|||.:||.|||||:|:.|.:.:|..:.||
  Rat   101 EKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAFLKKL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 40/92 (43%)
Txn2NP_445783.1 TRX_family 72..162 CDD:239245 39/89 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43601
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.