DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and Txn2

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_064297.1 Gene:Txn2 / 56551 MGIID:1929468 Length:166 Species:Mus musculus


Alignment Length:148 Identity:53/148 - (35%)
Similarity:84/148 - (56%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RMAPQA--ARGTQKYLSQSQH--------------LHKMLV------IKDHYEFDQKVINSDNPV 70
            |..||.  |..|.|.|...|:              :|...|      ::|..:|..:|:||:.||
Mouse    17 RKPPQGVWASLTSKTLQTPQYNAGGLTVMPSPARTVHTTRVCLTTFNVQDGPDFQDRVVNSETPV 81

  Fly    71 IVNFHAEWCDPCKILTPKMLELL-ENSNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVD 134
            :|:|||:||.|||||.|::.::: :...::.:|.:|::.:.||...:||.|||.|||.:||.|||
Mouse    82 VVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVD 146

  Fly   135 KFIGLVDANSIETLIDKL 152
            ||:|:.|.:.:|..:.||
Mouse   147 KFVGIKDEDQLEAFLKKL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 40/92 (43%)
Txn2NP_064297.1 TRX_family 72..162 CDD:239245 39/89 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0910
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.