DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and SMAD1

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001003688.1 Gene:SMAD1 / 4086 HGNCID:6767 Length:465 Species:Homo sapiens


Alignment Length:48 Identity:12/48 - (25%)
Similarity:26/48 - (54%) Gaps:4/48 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKRKQ 156
            |:..:.:|...||..:|.::.|...:|:.    ..:::.|:.|||:|:
Human     2 NVTSLFSFTSPAVKRLLGWKQGDEEEKWA----EKAVDALVKKLKKKK 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 8/40 (20%)
SMAD1NP_001003688.1 MH1_SMAD_1_5_9 9..132 CDD:199814 11/41 (27%)
PRK10263 <133..>244 CDD:236669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..248
MH2_SMAD_1_5_9 265..465 CDD:199822
L3 loop. /evidence=ECO:0000269|PubMed:11779505 418..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S660
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.