powered by:
Protein Alignment CG3719 and SMAD1
DIOPT Version :9
Sequence 1: | NP_651990.1 |
Gene: | CG3719 / 44736 |
FlyBaseID: | FBgn0024986 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001003688.1 |
Gene: | SMAD1 / 4086 |
HGNCID: | 6767 |
Length: | 465 |
Species: | Homo sapiens |
Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
Similarity: | 26/48 - (54%) |
Gaps: | 4/48 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 NLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKRKQ 156
|:..:.:|...||..:|.::.|...:|:. ..:::.|:.|||:|:
Human 2 NVTSLFSFTSPAVKRLLGWKQGDEEEKWA----EKAVDALVKKLKKKK 45
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.75 |
Normalized mean entropy |
S660 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.