DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and Txndc8

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001004092.1 Gene:Txndc8 / 362525 RGDID:1303121 Length:127 Species:Rattus norvegicus


Alignment Length:126 Identity:32/126 - (25%)
Similarity:54/126 - (42%) Gaps:25/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IKDHYEFDQKVINSDNP-VIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVIDVETNLDLVETF 116
            ||...||.:.:..:.|. |:|.|.|:||.|||::.|....:......:..|.:||:::.:|.|..
  Rat     5 IKSMREFKELLGAAGNRLVVVEFSAQWCGPCKMIAPAFQAMSLQYRNVMFAQVDVDSSQELTEHC 69

  Fly   117 EVKAVPA-------------------VLAFRNGVVVDKFIGLVDANSIETLIDKLKRKQQQ 158
            .::.||.                   :..||:|....|......|:     |:||:.|.|:
  Rat    70 SIQVVPTFQMFKHSRKVTPFSRLKRILCCFRSGPGSKKIFEFQGAD-----IEKLEEKIQE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 25/111 (23%)
Txndc8NP_001004092.1 Thioredoxin_like 1..89 CDD:412351 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.