DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and CG14221

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster


Alignment Length:118 Identity:21/118 - (17%)
Similarity:53/118 - (44%) Gaps:7/118 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QHLHKMLVIKDHYEFDQKVINSDNPVIVNFHAEWCDPC--KILTPKMLELLENSNEIDLAVIDVE 107
            |.|...|...:.:|   |.:.....::::.::|||.||  .:.:.:.::|....:.:.||:... 
  Fly     8 QQLQADLASDEEFE---KFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKA- 68

  Fly   108 TNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKRKQQQKQ 160
            .::..::.|..|:.|..:...:|..::...| .|...:..:|.::.:....|:
  Fly    69 GSISYLKRFNKKSEPTWMFVTSGKAINIMFG-TDVPKLVAMITRMLQSTMAKE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 16/93 (17%)
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 18/104 (17%)
DUF4746 233..508 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.