DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and pdia6

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_922915.2 Gene:pdia6 / 322160 ZFINID:ZDB-GENE-030131-879 Length:440 Species:Danio rerio


Alignment Length:150 Identity:37/150 - (24%)
Similarity:63/150 - (42%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IGAKSRGQRMAPQAARGTQKYLSQSQHLHKMLVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCKI 84
            :|.|:.|...:.|:..|...        .|.:|......||:.|:.||:..:|.|.|.||..||.
Zfish   139 LGGKTGGSDYSRQSGGGAGN--------KKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKN 195

  Fly    85 LTPK----MLELLENS-NEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVDKFIG-----L 139
            |.|:    ..|:.|.: .::.||..|...:..|...|.::..|.:..||.|...:.:.|     .
Zfish   196 LEPEWTAAATEVKEQTKGKVRLAAEDATVHQGLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSD 260

  Fly   140 VDANSIETLIDKLKRKQQQK 159
            :.|.::|...|.:...:.|:
Zfish   261 IVARALELYSDNIPAPELQE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 28/101 (28%)
pdia6NP_922915.2 ER_PDI_fam 25..262 CDD:273457 33/130 (25%)
PDI_a_P5 26..128 CDD:239299
PDI_a_P5 161..266 CDD:239299 28/104 (27%)
P5_C 275..404 CDD:239281 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.