DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and Txndc2

DIOPT Version :10

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001139476.1 Gene:Txndc2 / 316777 RGDID:1359251 Length:550 Species:Rattus norvegicus


Alignment Length:104 Identity:30/104 - (28%)
Similarity:51/104 - (49%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VIKDHYEFDQKVINS-DNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVIDVETNLDLVET 115
            ||||..||::.:.:: :..|.|:|.|.||.||:.:.|....|.....::....:|.|....||:.
  Rat   449 VIKDKEEFEEVLKDAGEKLVAVDFSAPWCGPCRKMRPHFHSLSLKHEDVIFLEVDTEDCEQLVQD 513

  Fly   116 FEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKR 154
            .||..:|....::|...|.:|.|        .|::||::
  Rat   514 CEVFHLPTFQFYKNEEKVGEFSG--------ALVEKLEK 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 CnoX 58..150 CDD:442352 24/92 (26%)
Txndc2NP_001139476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..428
22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I 104..440
PTZ00121 <151..466 CDD:173412 6/16 (38%)
TRX_family 454..547 CDD:239245 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.