DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and Txndc2

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001139476.1 Gene:Txndc2 / 316777 RGDID:1359251 Length:550 Species:Rattus norvegicus


Alignment Length:104 Identity:30/104 - (28%)
Similarity:51/104 - (49%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VIKDHYEFDQKVINS-DNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVIDVETNLDLVET 115
            ||||..||::.:.:: :..|.|:|.|.||.||:.:.|....|.....::....:|.|....||:.
  Rat   449 VIKDKEEFEEVLKDAGEKLVAVDFSAPWCGPCRKMRPHFHSLSLKHEDVIFLEVDTEDCEQLVQD 513

  Fly   116 FEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKR 154
            .||..:|....::|...|.:|.|        .|::||::
  Rat   514 CEVFHLPTFQFYKNEEKVGEFSG--------ALVEKLEK 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 24/92 (26%)
Txndc2NP_001139476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..428
22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I 104..440
PTZ00121 <151..466 CDD:173412 6/16 (38%)
TRX_family 454..547 CDD:239245 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.