DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and PDIA3

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_005304.3 Gene:PDIA3 / 2923 HGNCID:4606 Length:505 Species:Homo sapiens


Alignment Length:126 Identity:34/126 - (26%)
Similarity:58/126 - (46%) Gaps:19/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KMLVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLEL---LENSNEIDLAVIDVETNL 110
            |::|.::   ||:.|.|.:..|::.|:|.||..||.|.||..||   |.....|.:|.:|...| 
Human   379 KVVVAEN---FDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN- 439

  Fly   111 DLVETFEVKAVPAVL-----------AFRNGVVVDKFIGLVDANSIE-TLIDKLKRKQQQK 159
            |:...:||:..|.:.           .:..|..:..||..:...:.. .:|.:.|.|:::|
Human   440 DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 28/106 (26%)
PDIA3NP_005304.3 YbbN 25..487 CDD:331940 30/111 (27%)
ER retention motif 502..505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.