DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and ZNF396

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001309215.1 Gene:ZNF396 / 252884 HGNCID:18824 Length:335 Species:Homo sapiens


Alignment Length:33 Identity:11/33 - (33%)
Similarity:14/33 - (42%) Gaps:6/33 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LTPKMLELL------ENSNEIDLAVIDVETNLD 111
            :.||.|:..      ||..|....:.|||..||
Human   103 ILPKELQAWVQKHHPENGEETVTMLEDVERELD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 11/33 (33%)
ZNF396NP_001309215.1 SCAN 48..157 CDD:128708 11/33 (33%)
SCAN 48..136 CDD:280241 11/33 (33%)
COG5048 239..>306 CDD:227381
zf-C2H2 252..273 CDD:278523
C2H2 Zn finger 253..273 CDD:275368
zf-H2C2_2 269..290 CDD:290200
C2H2 Zn finger 281..301 CDD:275368
zf-H2C2_2 294..318 CDD:290200
C2H2 Zn finger 309..329 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S660
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.