powered by:
Protein Alignment CG3719 and ZNF396
DIOPT Version :9
Sequence 1: | NP_651990.1 |
Gene: | CG3719 / 44736 |
FlyBaseID: | FBgn0024986 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001309215.1 |
Gene: | ZNF396 / 252884 |
HGNCID: | 18824 |
Length: | 335 |
Species: | Homo sapiens |
Alignment Length: | 33 |
Identity: | 11/33 - (33%) |
Similarity: | 14/33 - (42%) |
Gaps: | 6/33 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 LTPKMLELL------ENSNEIDLAVIDVETNLD 111
:.||.|:.. ||..|....:.|||..||
Human 103 ILPKELQAWVQKHHPENGEETVTMLEDVERELD 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.75 |
Normalized mean entropy |
S660 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.