DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and trx-2

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001256207.1 Gene:trx-2 / 179434 WormBaseID:WBGene00007099 Length:145 Species:Caenorhabditis elegans


Alignment Length:121 Identity:42/121 - (34%)
Similarity:63/121 - (52%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PQAARGTQKYLSQSQHLHKMLVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELLE- 94
            |..|......|....|...:..|....:|.:|||.|..||||:||||||.||:.|.|::.|.:. 
 Worm    20 PTLATSKMTQLRHFSHGASVFDIDSVEDFTEKVIQSSVPVIVDFHAEWCGPCQALGPRLEEKVNG 84

  Fly    95 NSNEIDLAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLID 150
            ....:.||.|:|:...:|...:.:.|||.|.||:||..:..|.|::|...::..|:
 Worm    85 RQGSVLLAKINVDHAGELAMDYGISAVPTVFAFKNGEKISGFSGVLDDEQLDDFIE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 36/92 (39%)
trx-2NP_001256207.1 TRX_family 46..140 CDD:239245 36/93 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43601
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X935
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.