DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3719 and dnj-27

DIOPT Version :9

Sequence 1:	NP_651990.1	Gene:	CG3719 / 44736	FlyBaseID:	FBgn0024986	Length:	160	Species:	Drosophila melanogaster
Sequence 2:	NP_001040704.1	Gene:	dnj-27 / 173065	WormBaseID:	WBGene00001045	Length:	788	Species:	Caenorhabditis elegans

Alignment Length:	90	Identity:	24/90 - (26%)
Similarity:	43/90 - (47%)	Gaps:	11/90 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    58 EFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELL-ENSNEIDLAVIDVETNLDLVETFEVKAV 121
            :|...|::|..|.||:|.|.||..|....|...::. |.:.:::.|.||.:....:.:..:|:|.
Worm   678 DFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDQIAKELAGKVNFAKIDCDQWPGVCQGAQVRAY 742

  Fly   122 PAVLAF-------RNGVVVDKFIGL 139
            |.:..:       |.|   |:.||:
Worm   743 PTIRLYTGKTGWSRQG---DQGIGI 764

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3719	NP_651990.1	TRX_family	58..150	CDD:239245	24/90 (27%)
dnj-27	NP_001040704.1	DnaJ	18..>150	CDD:223560
		DnaJ	20..82	CDD:278647
		PDI_a_ERdj5_N	116..214	CDD:239301
		Thioredoxin_like	222..>312	CDD:294274
		ER_PDI_fam	438..750	CDD:273457	19/71 (27%)
		PDI_a_ERdj5_C	438..543	CDD:239302
		PDI_a_ERdj5_C	549..664	CDD:239302
		PDI_a_ERdj5_C	670..773	CDD:239302	24/90 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910