DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3719 and XB5909790

DIOPT Version :9

Sequence 1:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001123670.1 Gene:XB5909790 / 100170420 XenbaseID:XB-GENE-5909791 Length:105 Species:Xenopus tropicalis


Alignment Length:95 Identity:29/95 - (30%)
Similarity:51/95 - (53%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EFDQKVIN--SDNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVIDVETNLDLVETFEVKA 120
            || |.::.  .|..|:|:|.|.||.|||:::|...:|...:.::....:||:...|:....:||.
 Frog    10 EF-QNILKEAGDKLVVVDFTATWCGPCKMISPVFEKLSVENPDVVFIKVDVDDAQDVAAHCDVKC 73

  Fly   121 VPAVLAFRNGVVVDKFIGLVDANSIETLID 150
            :|....::||..|.:|.|...|:.|:.:.|
 Frog    74 MPTFHFYKNGQKVHEFSGANQASLIQKVQD 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 28/93 (30%)
XB5909790NP_001123670.1 TRX_family 9..100 CDD:239245 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.