DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED6 and MED6

DIOPT Version :9

Sequence 1:NP_001163577.1 Gene:MED6 / 44728 FlyBaseID:FBgn0024330 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_011925.1 Gene:MED6 / 856455 SGDID:S000001100 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:71/307 - (23%)
Similarity:109/307 - (35%) Gaps:114/307 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSWHDTQMMAT--LSPQTVMDYFCRKSNPFYDHMCNNETVRMQR--------------------- 54
            |.|...:.:..  |..:.|:|||.  .:||:|...||:.::|||                     
Yeast     9 LQWKSPEWIQVFGLRTENVLDYFA--ESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTL 71

  Fly    55 --------------LGP----------------EHLHNMIGLEYILLHVAEPILYVIRKQHRHNP 89
                          :.|                |.|..:.|.||:|..|.||..:|||||.|.|.
Yeast    72 PDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNN 136

  Fly    90 S--------EATPIADYYIIGGTVYKAPDLANVINSRILNTVVNLQSAFEEASSYARYHPNKGYT 146
            |        |..|:.||||||..:|::|.:..::.||:::|..:|.|..|.......:.|::|..
Yeast   137 SGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVH 201

  Fly   147 WDFSSNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFPPPIPPMLQNLQQPPPA 211
            :     ||.:|.|.:.....|.   .|:|....|..|                        .|..
Yeast   202 Y-----KVPTDTSTTATAATNG---NNAGGGSNKSSV------------------------RPTG 234

  Fly   212 GDDLNTARNASEMN--------------NAT-----GPLDIKTEGVD 239
            |.::.|..:.:.:|              |.|     |.:.|.||.:|
Yeast   235 GANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED6NP_001163577.1 Med6 13..139 CDD:282750 49/186 (26%)
MED6NP_011925.1 MED6 1..283 CDD:227428 71/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5097
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005042
OrthoInspector 1 1.000 - - oto99920
orthoMCL 1 0.900 - - OOG6_102673
Panther 1 1.100 - - LDO PTHR13104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2638
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.