DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED6 and MED6

DIOPT Version :9

Sequence 1:NP_001163577.1 Gene:MED6 / 44728 FlyBaseID:FBgn0024330 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001154633.1 Gene:MED6 / 821689 AraportID:AT3G21350 Length:298 Species:Arabidopsis thaliana


Alignment Length:264 Identity:80/264 - (30%)
Similarity:117/264 - (44%) Gaps:63/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VMDYFCRKSNPFYDHMCNNETVRMQRLGP---EHLHNMIGLEYILLHVAEPILYVIRKQHRHNPS 90
            :.|||.  .:||||..||||.:|.:.:.|   .||..|.||||:|....||.|:|.|||.|..|.
plant    54 IFDYFA--LSPFYDTTCNNEILRRRSIHPLDLSHLSKMTGLEYMLTDATEPNLFVFRKQKRDGPE 116

  Fly    91 EATPIADYYIIGGTVYKAPDLANVINSRILNTVVNLQSAFEEASS-------------------- 135
            :.||:..|||:.|::|:||.|.:|..:|:..|:.|:..||.:|:|                    
plant   117 KVTPMLTYYILDGSIYQAPQLCSVFAARVSRTIYNISKAFTDAASKLETIRQDLQVCLVAIVLSL 181

  Fly   136 ----------YARYHPNKGYTWDFSSNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAEL 190
                      ..:...|....:.|  ||...| :::..:.|.|.....:..|.:.:|||::|..|
plant   182 SVNLGSYFLLIFKLMANGEQVYGF--NKFLFD-TENQNEPAESKPASETVDLKEMKRVDVILTSL 243

  Fly   191 LRKFPPPIPPMLQNLQQPP-PAGDDLNTARNASEMNNATGPLDIKTEGVDMKPP---------PE 245
            .||..||.||       || |.|.....|....|        ::.|:|.:.:||         |.
plant   244 YRKLAPPPPP-------PPFPEGYVSQEALGEKE--------ELGTQGGESQPPQVDPIIDQGPA 293

  Fly   246 KKSK 249
            |:.|
plant   294 KRMK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED6NP_001163577.1 Med6 13..139 CDD:282750 48/142 (34%)
MED6NP_001154633.1 Med6 36..161 CDD:282750 48/139 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I2365
eggNOG 1 0.900 - - E1_COG5097
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3990
Inparanoid 1 1.050 108 1.000 Inparanoid score I2099
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251252at2759
OrthoFinder 1 1.000 - - FOG0005042
OrthoInspector 1 1.000 - - oto2978
orthoMCL 1 0.900 - - OOG6_102673
Panther 1 1.100 - - LDO PTHR13104
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5378
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.