DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED6 and med6

DIOPT Version :9

Sequence 1:NP_001163577.1 Gene:MED6 / 44728 FlyBaseID:FBgn0024330 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001016292.1 Gene:med6 / 549046 XenbaseID:XB-GENE-967312 Length:246 Species:Xenopus tropicalis


Alignment Length:259 Identity:116/259 - (44%)
Similarity:160/259 - (61%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASRQMTNDHLRLSWHDTQMMATLSPQTVMDYFCRKSNPFYDHMCNNETVRMQRLGPEHLHNMIG 65
            ||:..:.::.|.:||.|:..:..|:..||:|||..:||||||..||||.|:||||..:||:.|:|
 Frog     1 MAAVDIRDNLLGISWVDSSWIPILNNGTVLDYFSERSNPFYDRTCNNEVVKMQRLTLDHLNQMVG 65

  Fly    66 LEYILLHVAEPILYVIRKQHRHNPSEATPIADYYIIGGTVYKAPDLANVINSRILNTVVNLQSAF 130
            :||||||..||||::||||.|.:|::..|:||||||.|.:|:||||.:|||||:|..|..:||||
 Frog    66 IEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAF 130

  Fly   131 EEASSYARYHPNKGYTWDFSSNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFP 195
            :||.||.||||:|||.|.      |.|:.:.||....:.|.|.:.:.||:||||.||.||.:|||
 Frog   131 DEAMSYCRYHPSKGYWWH------FKDQEERDKTKPKAKKKEEASSHFQRQRVDALLMELRQKFP 189

  Fly   196 P----------PIPPMLQNLQQPPPAGDDLNTARNASEMNNATGPLDIKTEGVDMKPPPEKKSK 249
            |          |:|......:..|||    .|.:...:     .|:.:..:|...|.||||:.:
 Frog   190 PKFIQQKTGEKPVPVEQIKKEAEPPA----ETIKQEEK-----EPVKVAQQGATPKGPPEKRMR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED6NP_001163577.1 Med6 13..139 CDD:282750 72/125 (58%)
med6NP_001016292.1 Med6 13..139 CDD:368200 72/125 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 160 1.000 Domainoid score I4019
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3990
Inparanoid 1 1.050 216 1.000 Inparanoid score I3517
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251252at2759
OrthoFinder 1 1.000 - - FOG0005042
OrthoInspector 1 1.000 - - oto104472
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2638
SonicParanoid 1 1.000 - - X5378
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.