DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED6 and mdt-6

DIOPT Version :9

Sequence 1:NP_001163577.1 Gene:MED6 / 44728 FlyBaseID:FBgn0024330 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_504791.3 Gene:mdt-6 / 179091 WormBaseID:WBGene00003164 Length:250 Species:Caenorhabditis elegans


Alignment Length:199 Identity:74/199 - (37%)
Similarity:123/199 - (61%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASRQMTNDHLRLSWHDTQMMAT-LSPQTVMDYFCRKSNPFYDHMCNNETVRMQ----RLGPEHLH 61
            |:||  ::.|.:|:.:.|.... ::...|:||||.::|.||:....|:.:|||    |...|.|.
 Worm    10 AARQ--DNPLHVSFRNPQWPPNFINKDNVLDYFCNQANAFYEMNSCNQQIRMQNIVNRTVEECLR 72

  Fly    62 NMIGLEYILLHVAEPILYVIRKQHRHNPSEATPIADYYIIGGTVYKAPDLANVINSRILNTVVNL 126
            .|.|::|:|.: ::|.|::|.||.|:|.:..:|||.||:|.|:|::|||:.:::.||:|..:..|
 Worm    73 TMPGIQYVLWY-SQPPLFIICKQRRNNVTNVSPIAYYYVINGSVHQAPDMYSLVQSRLLGALEPL 136

  Fly   127 QSAFEEASSYARYHPNKGYTWDFSSNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELL 191
            ::||.|.::|:||:..|||.|:| .||....:.:.:||:....|.|:..|.|||.|..|||.:|.
 Worm   137 RNAFGEVTNYSRYNTAKGYYWEF-KNKPNVKKREEEKKEDEEEKLEDRSTNFQKTRTMMLLNQLF 200

  Fly   192 RKFP 195
            .:.|
 Worm   201 SEMP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED6NP_001163577.1 Med6 13..139 CDD:282750 47/130 (36%)
mdt-6NP_504791.3 Med6 19..149 CDD:282750 47/130 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162761
Domainoid 1 1.000 98 1.000 Domainoid score I4530
eggNOG 1 0.900 - - E1_COG5097
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3990
Inparanoid 1 1.050 131 1.000 Inparanoid score I3202
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55402
OrthoDB 1 1.010 - - D1251252at2759
OrthoFinder 1 1.000 - - FOG0005042
OrthoInspector 1 1.000 - - oto19042
orthoMCL 1 0.900 - - OOG6_102673
Panther 1 1.100 - - LDO PTHR13104
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2638
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.