DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and MAK3

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_015376.1 Gene:MAK3 / 856163 SGDID:S000006255 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:36/132 - (27%)
Similarity:60/132 - (45%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ELAKLAYYN-----DIVVGAVCCRIDNTENQR-RLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEK 102
            ||..:|..|     :|.:|.:.|::|...|.| |.||..|...|.||..||...:.|..::..::
Yeast    45 ELTYIAVDNKSGTPNIPIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQR 109

  Fly   103 DGNFDSIFLHVQINNNGAIEFYKKFGFEIVDTKEQYYKRIEPADAHVLQKTLRRTAPNSNSTATS 167
            : :.|.|.|..::.|:.|:..|:..||..:....:||  :...||..|      ..|.:..:.|.
Yeast   110 E-HCDEIMLETEVENSAALNLYEGMGFIRMKRMFRYY--LNEGDAFKL------ILPLTEKSCTR 165

  Fly   168 TT 169
            :|
Yeast   166 ST 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 30/106 (28%)
Acetyltransf_1 50..130 CDD:278980 24/85 (28%)
MAK3NP_015376.1 RimI 26..162 CDD:223532 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.