DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment san and NAA11

DIOPT Version :9

Sequence 1:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_116082.1 Gene:NAA11 / 84779 HGNCID:28125 Length:229 Species:Homo sapiens


Alignment Length:157 Identity:34/157 - (21%)
Similarity:76/157 - (48%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IELGDVTPHNIKQLKKLNTVVFPVSYNDKFYV-DVLEAGELAKLAYYND-IVVGAVCCRI-DNTE 67
            :.:.:..|.::..::..|.:..|.:|..|:|: ..|...:|:.:|...| .:||.|..:: :..:
Human     1 MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEEPD 65

  Fly    68 NQRRLYIMTLGCLSPYRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKK-FGFEI 131
            :....:|.:|.....:||||:...:.:.......::.|...:.|||:.:|..|:..|.. ..|:|
Human    66 DVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALHLYSNTLNFQI 130

  Fly   132 VDTKEQYYKRIEPADAHVLQKTLRRTA 158
            .:.:.:||  .:..||:.:::.|.:.|
Human   131 SEVEPKYY--ADGEDAYAMKRDLSQMA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sanNP_524779.1 RimI <27..145 CDD:223532 28/121 (23%)
Acetyltransf_1 50..130 CDD:278980 17/82 (21%)
NAA11NP_116082.1 RimI 1..149 CDD:223532 32/149 (21%)
Interaction with NAA15. /evidence=ECO:0000250 1..58 13/56 (23%)
Acetyltransf_1 47..122 CDD:278980 16/74 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..229
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.